PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 450aa    MW: 49729.8 Da    PI: 7.0147
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012390genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64e-11310369564
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                  kr +r   NR++A rs +RK  +i eLe+kv++L+ae ++L  ++  l+  +++l+++++
  Lus10012390 310 KRVKRILANRLSAARSKERKMRYISELEQKVQTLQAEATTLSAQVTVLQRDSSNLTNQNH 369
                  899****************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.4E-19306370IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139308371IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-11310366No hitNo description
Gene3DG3DSA:1.20.5.1704.2E-11310367No hitNo description
PfamPF001709.5E-10310368IPR004827Basic-leucine zipper domain
CDDcd147034.58E-22311360No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MCDSMRQSSP SDSLEEASSN KRIGLPPSHP NNHHILSSGL VSDQQQVGLN RGRPSHLRSL  60
SQSSMFYLDC FPPLSPLQNP SMVGDVSMEE KAGVSLGLLV PGSKVKEGLP PRRGHRRSMS  120
DNVPLGFGAM IQSSPQLIPI GGQGGFDRFE LVKQEAEGMG DRRSMVEVGD DMLNAYMDNI  180
DPLNSYGTED KDWDSRVSGT KTNGTENSDN EAESHIKGLK RNADGDIGPA GRHYRSVSMD  240
SFMGNLRLDD ELMMLPPAVN RIGQLSPSGS MQGSLTKFNL EFVNGEFTEA ELKKIMSNDK  300
LTELAMADPK RVKRILANRL SAARSKERKM RYISELEQKV QTLQAEATTL SAQVTVLQRD  360
SSNLTNQNHE LKFRLQAMEQ QAQLKDALNE ALVGEVQRLR LAATDVGADT SHHHHQQQQQ  420
LLGNIMQQQN AYQHQRQRST QLNQAQSSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073848.11e-158PREDICTED: transcription factor VIP1-like
TrEMBLA0A067KLE41e-158A0A067KLE4_JATCU; Uncharacterized protein
STRINGVIT_03s0038g00860.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-109bZIP family protein